PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G312100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family CPP
Protein Properties Length: 551aa    MW: 59062.5 Da    PI: 7.1032
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G312100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.33.5e-1489128242
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                         ++k+CnCk+skClk+YCeCfa+g +C+  C+C +C N+ e+
  Phvul.002G312100.1  89 KQKQCNCKHSKCLKLYCECFASGIYCEG-CNCVNCYNNVEN 128
                         89*************************9.********9875 PP

2TCR512.8e-16173212140
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Phvul.002G312100.1 173 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 212
                         589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.0E-1688128IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.11789213IPR005172CRC domain
PfamPF036384.8E-1190125IPR005172CRC domain
SMARTSM011148.4E-20173214IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.0E-12176211IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 551 aa     Download sequence    Send to blast
MGEGEGEGSD CAPKNVVTND VVANALLPSE VPAKKLARQL DFTGFGGMPP QPPVVLPLPS  60
SASVRVGKPE SPKSRPRPGF EIKEATPKKQ KQCNCKHSKC LKLYCECFAS GIYCEGCNCV  120
NCYNNVENEA ARREAVEATL ERNPNAFRPK IASSPHGTRD SREDAGEILI LGKHNKGCHC  180
KKSGCLKKYC ECFQANILCS ENCKCMDCKN FEGSEERQAL FHGDQNNNMV YIQQAANAAI  240
TGAIGSSGFS SPPISKKRKG QELLFGSAIK DPSLGRLGQQ ANNVRVPAPS SSLSPIPGAR  300
VGPSTLGPSK LMYRSLLADI IQPQHLKELC SVLVLVSGQA AKTFTDQKNL MDKHGEDHTE  360
TSLASSTQEQ LPNQKEANVE KPMADDDCLS ANQTDKISPE NSCSDGADVP KGRPMSPGTL  420
ALMCDEQDTM FMTSASPIGS RAHACNTSSQ PQYGQGMTEV YAEQERIVLT KFRDFLNRVI  480
TMGEINETKC SSLARSELES QKEPNNNCTG NASTTETDHQ QGTTNNGVAK AAGSITSTSS  540
FPGGSLIPEK *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014505757.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A0S3QWY90.0A0A0S3QWY9_PHAAN; Uncharacterized protein
TrEMBLA0A0L9VSR50.0A0A0L9VSR5_PHAAN; Uncharacterized protein
STRINGGLYMA05G35561.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26263379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-165Tesmin/TSO1-like CXC domain-containing protein